| Anti-CRISPR ID: | anti_CRISPR3680 |
| Accession: | WP_017907426.1 |
| Anti-CRISPR type: | I-C |
| Family: | AcrIC10 |
| Organism: | |
| Taxonomy: | Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales;Xanthomonadaceae; Xanthomonas |
| Uniprot entry: | -- |
| Uniprot entry name: | -- |
| Structure: | -- |
| Inhibition stage: | |
| Complexed with: | |
| Interactor (DIP): | -- |
| Interactor (STRING): | -- |
| Protein sequence: | MQKINPEWVKFNNLFNEGYTDSYNPHPKYITVAAAAAVAAPAASSGKVYRDSRGMPIDPAAKIAEESARLEGVTDAFARELIEKSIANYRKMLEC |
| Length of sequence: | 95 |
| Verified: | Verfied |
| Comments: | inhibit the Type I-C CRISPR/Cas system |
| Pubmed: | PMID:32728052 Gussow AB, Park AE, Borges AL, et al. Machine-learning approach expands the repertoire of anti-CRISPR protein families. Nat Commun. 2020;11(1):3784. Published 2020 Jul 29. doi:10.1038/s41467-020-17652-0 |
| Locus tag: | D183_RS0101545 |
| Coding region: | AQOI01000027.1:21474-21761 |
| Gene name: | -- |
| Gene ID: | -- |
| Gene Sequence: | -- |
| IDs | Q.start | Q.end | S.start | S.end | Identity | E-value |