| Anti-CRISPR ID: | anti_CRISPR3664 |
| Accession: | NP_666617.1 |
| Anti-CRISPR type: | III-1 |
| Family: | AcrIII1 |
| Organism: | |
| Taxonomy: | Viruses; Ligamenvirales; Rudiviridae; Rudivirus |
| Uniprot entry: | Q8QL27 |
| Uniprot entry name: | Y114_SIRV1 |
| Structure: | 2X4I: 6SCF: |
| Inhibition stage: | |
| Complexed with: | |
| Interactor (DIP): | -- |
| Interactor (STRING): | -- |
| Protein sequence: | MNKVYLANAFSINMLTKFPTKVVIDKIDRLEFCENIDNEDIINSIGHDSTIQLINSLCGTTFQKNRVEIKLEKEDKLYVVQISQRLEEGKILTLEEILKLYESGKVQFFEIIVD |
| Length of sequence: | 114 |
| Verified: | Verified |
| Comments: | inhibit any type III CRISPR sub-type that utilizes cA4 molecules for defence |
| Pubmed: | PMID:31942067 Athukoralage JS, McMahon SA, Zhang C, et al. An anti-CRISPR viral ring nuclease subverts type III CRISPR immunity. Nature. 2020;577(7791):572‐575. |
| Locus tag: | SIRV1gp29 |
| Coding region: | NC_004087.1:16362..16706 |
| Gene name: | 114 |
| Gene ID: | 951359 |
| Gene Sequence: | -- |
Anti-CRISPRdb
Database of anti-CRISPR proteins