| Anti-CRISPR ID: | anti_CRISPR3663 |
| Accession: | ACV38861.1 |
| Anti-CRISPR type: | VI-A |
| Family: | AcrVIA7 |
| Organism: | |
| Taxonomy: | Bacteria; Fusobacteria; Fusobacteriales; Leptotrichiaceae;Leptotrichia. |
| Uniprot entry: | C7N9N0  |
| Uniprot entry name: | C7N9N0_LEPBD |
| Structure: | -- |
| Inhibition stage: | |
| Complexed with: | |
| Interactor (DIP): | -- |
| Interactor (STRING): | 523794.Lebu_0959 |
| Protein sequence: | MRIIKLYERIIPKTSSTSYISRWEALNIPDENRNTAAWHPRTYLFSYDKDKAINLYNTTNVLGNSGIKKRIIDYPSKREVYIANFPRAIADLVLTMKDYQLSSLHNCCNDFFNEDETEQLYQYLRSIKDNRRVDEFLKYEFTVRYFNDKKF |
| Length of sequence: | 151 |
| Verified: | Verified |
| Comments: | inhibit the Type VI-A CRISPR/Cas system |
| Pubmed: | PMID:32348779 Lin P, Qin S, Pu Q, et al. CRISPR-Cas13 Inhibitors Block RNA Editing in Bacteria and Mammalian Cells. Mol Cell. 2020;78(5):850‐861.e5. doi:10.1016/j.molcel.2020.03.033 |
| Locus tag: | Lebu_0959 |
| Coding region: | complement(CP001685.1:1050595..1051050) |
| Gene name: | Lebu_0959 |
| Gene ID: | -- |
| Gene Sequence: | -- |