| Anti-CRISPR ID: | anti_CRISPR3662 |
| Accession: | ETD74580.1 |
| Anti-CRISPR type: | VI-A |
| Family: | AcrVIA6 |
| Organism: | |
| Taxonomy: | Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales;Rhodobacteraceae; Rhodobacter |
| Uniprot entry: | -- |
| Uniprot entry name: | -- |
| Structure: | -- |
| Inhibition stage: | |
| Complexed with: | |
| Interactor (DIP): | -- |
| Interactor (STRING): | -- |
| Protein sequence: | MADKVKSIQPGPIFYDVFLVYLRVIGTNLKDWCAPHGVTATNAKSAATGGWNGTKARALRQKMIDEVGEETFLRLYTERLRREAA |
| Length of sequence: | 85 |
| Verified: | Verified |
| Comments: | inhibit the Type VI-A CRISPR/Cas system |
| Pubmed: | PMID:32348779 Lin P, Qin S, Pu Q, et al. CRISPR-Cas13 Inhibitors Block RNA Editing in Bacteria and Mammalian Cells. Mol Cell. 2020;78(5):850‐861.e5. doi:10.1016/j.molcel.2020.03.033 |
| Locus tag: | U717_16030 |
| Coding region: | complement(AYQC01000030.1:17446..17703) |
| Gene name: | -- |
| Gene ID: | -- |
| Gene Sequence: | -- |
Anti-CRISPRdb
Database of anti-CRISPR proteins