| Anti-CRISPR ID: | anti_CRISPR3658 |
| Accession: | ERK51681.1 |
| Anti-CRISPR type: | VI-A |
| Family: | AcrVIA2 |
| Organism: | |
| Taxonomy: | Bacteria; Fusobacteria; Fusobacteriales; Leptotrichiaceae;Leptotrichia |
| Uniprot entry: | U2Q5N5 |
| Uniprot entry name: | U2Q5N5_LEPWF |
| Structure: | -- |
| Inhibition stage: | |
| Complexed with: | |
| Interactor (DIP): | -- |
| Interactor (STRING): | 888055.HMPREF9015_01064 |
| Protein sequence: | MWKCKKCGCDRFYQDITGGISEVLEMDKDGEVLDEIDDVEYGDFSCAKCDNSSSKIQEIAYWDEINGKNKTYLSKDK |
| Length of sequence: | 77 |
| Verified: | Verified |
| Comments: | inhibit the Type VI-A CRISPR/Cas system |
| Pubmed: | PMID:32348779 Lin P, Qin S, Pu Q, et al. CRISPR-Cas13 Inhibitors Block RNA Editing in Bacteria and Mammalian Cells. Mol Cell. 2020;78(5):850‐861.e5. doi:10.1016/j.molcel.2020.03.033 |
| Locus tag: | HMPREF9015_01064 |
| Coding region: | AWVM01000056.1:27971..28204 |
| Gene name: | HMPREF9015_01064 |
| Gene ID: | -- |
| Gene Sequence: | -- |
Anti-CRISPRdb
Database of anti-CRISPR proteins