| Anti-CRISPR ID: | anti_CRISPR3628 |
| Accession: | WP_050337628.1 |
| Anti-CRISPR type: | II-A |
| Family: | AcrIIA13 |
| Organism: | |
| Taxonomy: | Bacteria;Terrabacteria group;Firmicutes;Bacilli;Bacillales;Staphylococcaceae;Staphylococcus |
| Uniprot entry: | -- |
| Uniprot entry name: | -- |
| Structure: | -- |
| Inhibition stage: | |
| Complexed with: | |
| Interactor (DIP): | -- |
| Interactor (STRING): | -- |
| Protein sequence: | MEVMNKSIEIKDQNNIVLIDSLGQFFTDIENDNNGRYNIDYVLLNEVEHDNGNTYYEVGMYRTEEVPFSDKVTQDNVELLEDKWLQIDQQGESYVESIFFENEEDAREYIKLVLKGHETFEETAKAIGVIK |
| Length of sequence: | 131 |
| Verified: | Verified |
| Comments: | robust inhibition of SauCas9-induced genome editing |
| Pubmed: | PMID:32156733 Watters KE, Shivram H, Fellmann C, Lew RJ, McMahon B, Doudna JA. Potent CRISPR-Cas9 inhibitors from Staphylococcus genomes. Proc Natl Acad Sci U S A. 2020;117(12):6531‐6539. |
| Locus tag: | -- |
| Coding region: | -- |
| Gene name: | -- |
| Gene ID: | -- |
| Gene Sequence: | -- |
Anti-CRISPRdb
Database of anti-CRISPR proteins