Anti-CRISPR ID: | anti_CRISPR1062 |
Accession: | WP_047916330.1 |
Anti-CRISPR type: | II-A |
Family: | AcrIIA8 |
Organism: | |
Taxonomy: | Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus |
Uniprot entry: | -- |
Uniprot entry name: | -- |
Structure: | -- |
Inhibition stage: | |
Complexed with: | |
Interactor (DIP): | -- |
Interactor (STRING): | -- |
Protein sequence: | MSPIRKRLVFDLYKNTPVRGPSGSLKDAWVKQDNQIVVSVYDNSAQNQLTTGSSGARVKQYDYLGLTKKKTLITGKYRLEREGVKYLVKGVNNEGRLAQLFLEVLANG |
Length of sequence: | 108 |
Verified: | literature |
Comments: | -- |
Pubmed: | PMID:30737174 Uribe Ruben V,van der Helm Eric,Misiakou Maria-Anna et al. Discovery and Characterization of Cas9 Inhibitors Disseminated across Seven Bacterial Phyla.[J] .Cell Host Microbe, 2019, 25: 233-241.e5. |
Locus tag: | -- |
Coding region: | -- |
Gene name: | -- |
Gene ID: | -- |
Gene Sequence: | -- |
IDs | Q.start | Q.end | S.start | S.end | Identity | E-value |
anti_CRISPR0559 | 1 | 103 | 1 | 99 | 29.524 | 5.52e-08 |