| Anti-CRISPR ID: | anti_CRISPR1037 |
| Accession: | WP_040182891.1 |
| Anti-CRISPR type: | II-A |
| Family: | AcrIIA7 |
| Organism: | |
| Taxonomy: | Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales; Rhodobacteraceae; Phaeobacter |
| Uniprot entry: | A0A384FLE5 |
| Uniprot entry name: | A0A384FLE5_9RHOB |
| Structure: | -- |
| Inhibition stage: | |
| Complexed with: | |
| Interactor (DIP): | -- |
| Interactor (STRING): | -- |
| Protein sequence: | MSEVYYGTKQIKAVPMNRQAYNDYRGWELPADEDGSDAGFLVEYVDGGASNHPDHEGYISWSPADVFERAYQSSGSMNFGHALQAVKEGHRVARAGWNGKGMFIVLMPRLELPPFNTQGTARKVNDRTAKWIGEETPLDCQPYLAMWTADKKWQPGWLASQADMLADDWLIVAD |
| Length of sequence: | 174 |
| Verified: | literature |
| Comments: | -- |
| Pubmed: | PMID:30737174 Uribe Ruben V,van der Helm Eric,Misiakou Maria-Anna et al. Discovery and Characterization of Cas9 Inhibitors Disseminated across Seven Bacterial Phyla.[J] .Cell Host Microbe, 2019, 25: 233-241.e5. |
| Locus tag: | -- |
| Coding region: | -- |
| Gene name: | OO25_21730 |
| Gene ID: | -- |
| Gene Sequence: | -- |
| IDs | Q.start | Q.end | S.start | S.end | Identity | E-value |
| anti_CRISPR0558 | 77 | 172 | 1 | 102 | 43.137 | 3.84e-27 |
| anti_CRISPR0558 | 49 | 56 | 57 | 64 | 62.500 | 0.42 |
| anti_CRISPR0558 | 8 | 51 | 42 | 85 | 18.182 | 3.7 |