| Anti-CRISPR ID: | anti_CRISPR0992 |
| Accession: | WP_055213764.1 |
| Anti-CRISPR type: | II-A |
| Family: | AcrIIA7 |
| Organism: | |
| Taxonomy: | Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae; Dorea |
| Uniprot entry: | A0A173S7S6 |
| Uniprot entry name: | A0A173S7S6_9FIRM |
| Structure: | -- |
| Inhibition stage: | |
| Complexed with: | |
| Interactor (DIP): | -- |
| Interactor (STRING): | -- |
| Protein sequence: | MTFKEAFEAMKHGAKVKLPGWNGYWCWDDDKKTIMIHCRPKDSDKGQGKVLDIRETQRVEYTFMHTQRDDWMIADEENCGVLGGQSTFGFDDAIRYLKRGLKVARKGWNGKGMYLFLCFPASIEPKAENVEIYSARQSIAIRTADSSIVVGWNASQTDMLAEDWVFVE |
| Length of sequence: | 168 |
| Verified: | literature |
| Comments: | -- |
| Pubmed: | PMID:30737174 Uribe Ruben V,van der Helm Eric,Misiakou Maria-Anna et al. Discovery and Characterization of Cas9 Inhibitors Disseminated across Seven Bacterial Phyla.[J] .Cell Host Microbe, 2019, 25: 233-241.e5. |
| Locus tag: | -- |
| Coding region: | -- |
| Gene name: | ERS852573_00871 |
| Gene ID: | -- |
| Gene Sequence: | -- |
| IDs | Q.start | Q.end | S.start | S.end | Identity | E-value |
| anti_CRISPR0558 | 90 | 168 | 3 | 103 | 39.604 | 3.65e-20 |
| anti_CRISPR0558 | 1 | 43 | 1 | 35 | 41.860 | 1.30e-07 |