| Anti-CRISPR ID: | anti_CRISPR0971 |
| Accession: | WP_023748707.1 |
| Anti-CRISPR type: | II-A |
| Family: | AcrIIA7 |
| Organism: | |
| Taxonomy: | Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Phyllobacteriaceae; Mesorhizobium |
| Uniprot entry: | A0A0E2NM10 |
| Uniprot entry name: | A0A0E2NM10_9RHIZ |
| Structure: | -- |
| Inhibition stage: | |
| Complexed with: | |
| Interactor (DIP): | -- |
| Interactor (STRING): | -- |
| Protein sequence: | MDFGKALDALKEGKRVSRSGWNGKGMFLFLVAGSNFTVNREPLASIVGMGSEITYRPHIDMKDAEGKVVPWLASQTDMLAEDWDVVSLAVQADRVKVEV |
| Length of sequence: | 99 |
| Verified: | literature |
| Comments: | -- |
| Pubmed: | PMID:30737174 Uribe Ruben V,van der Helm Eric,Misiakou Maria-Anna et al. Discovery and Characterization of Cas9 Inhibitors Disseminated across Seven Bacterial Phyla.[J] .Cell Host Microbe, 2019, 25: 233-241.e5. |
| Locus tag: | -- |
| Coding region: | -- |
| Gene name: | X749_27900 |
| Gene ID: | -- |
| Gene Sequence: | -- |
| IDs | Q.start | Q.end | S.start | S.end | Identity | E-value |
| anti_CRISPR0558 | 1 | 86 | 1 | 102 | 42.157 | 5.16e-22 |