Anti-CRISPR ID: | anti_CRISPR0883 |
Accession: | WP_083223530.1 |
Anti-CRISPR type: | II-A |
Family: | AcrIIA7 |
Organism: | |
Taxonomy: | Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae; Sinorhizobium/Ensifer group |
Uniprot entry: | -- |
Uniprot entry name: | -- |
Structure: | -- |
Inhibition stage: | |
Complexed with: | |
Interactor (DIP): | -- |
Interactor (STRING): | -- |
Protein sequence: | MNFGNAIEHVKRGGRAARMGWNGQNMFVYLNRGSMPVTAAFPVNGVAPNLFDAGSPDTIPRMPNFNLKTPDGMTVTGWVASQVDMLADDWFIC |
Length of sequence: | 93 |
Verified: | literature |
Comments: | -- |
Pubmed: | PMID:30737174 Uribe Ruben V,van der Helm Eric,Misiakou Maria-Anna et al. Discovery and Characterization of Cas9 Inhibitors Disseminated across Seven Bacterial Phyla.[J] .Cell Host Microbe, 2019, 25: 233-241.e5. |
Locus tag: | -- |
Coding region: | -- |
Gene name: | -- |
Gene ID: | -- |
Gene Sequence: | -- |
IDs | Q.start | Q.end | S.start | S.end | Identity | E-value |
anti_CRISPR0558 | 1 | 92 | 1 | 101 | 37.624 | 1.69e-21 |