| Anti-CRISPR ID: | anti_CRISPR0523 |
| Accession: | WP_036292019.1 |
| Anti-CRISPR type: | I-F |
| Family: | AcrIF11 |
| Organism: | |
| Taxonomy: | Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;Methylocystaceae; Methylosinus. |
| Uniprot entry: | -- |
| Uniprot entry name: | -- |
| Structure: | -- |
| Inhibition stage: | |
| Complexed with: | |
| Interactor (DIP): | -- |
| Interactor (STRING): | -- |
| Protein sequence: | MATMHLIHGSSKAHIDGITETGIFGGIFTLDYNPGCVNHGYGEHLHIVSLDDSEICRHGDITERLSRERIDEVIAGEIDLDALDEYDIDENERAEVLNMLRRWALETDDANSIEIYFGGDDCEYGGIFEEILVGAQAFDAGSLGFEIQRIRGLLARAAGFRAVDCYDENGISTLVIGGIGTKIMPLEEFEKASV |
| Length of sequence: | 194 |
| Verified: | literature |
| Comments: | -- |
| Pubmed: | PMID:30190308 Marino Nicole D,Zhang Jenny Y,Borges Adair L et al. Discovery of widespread type I and type V CRISPR-Cas inhibitors.[J] .Science, 2018, 362: 240-242. |
| Locus tag: | -- |
| Coding region: | -- |
| Gene name: | -- |
| Gene ID: | -- |
| Gene Sequence: | -- |
| IDs | Q.start | Q.end | S.start | S.end | Identity | E-value |
| anti_CRISPR0499 | 128 | 178 | 99 | 149 | 43.137 | 6.88e-13 |
| anti_CRISPR0490 | 3 | 178 | 2 | 126 | 25.000 | 4.25e-09 |
| anti_CRISPR0498 | 137 | 175 | 101 | 139 | 41.026 | 2.10e-06 |