| Anti-CRISPR ID: | anti_CRISPR0519 |
| Accession: | WP_039494318.1 |
| Anti-CRISPR type: | I-F |
| Family: | AcrIF11 |
| Organism: | |
| Taxonomy: | Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;Pectobacteriaceae; Pectobacterium. |
| Uniprot entry: | -- |
| Uniprot entry name: | -- |
| Structure: | -- |
| Inhibition stage: | |
| Complexed with: | |
| Interactor (DIP): | -- |
| Interactor (STRING): | -- |
| Protein sequence: | MKLFHGSSSNAAPVIKIGAFATVEVNVFDGIFASADWDAAASHGNAGRGGNVFSYSVDDENIAESRDLDARFEEVYEFLRAELGTHDVEEIADHIIWDKNQGEEFAERLSPRLDSDIGGAYSWEMQRLRGRVAAHLGFDAVEMDDEHGTSYLIVNPAIIAE |
| Length of sequence: | 161 |
| Verified: | literature |
| Comments: | -- |
| Pubmed: | PMID:30190308 Marino Nicole D,Zhang Jenny Y,Borges Adair L et al. Discovery of widespread type I and type V CRISPR-Cas inhibitors.[J] .Science, 2018, 362: 240-242. |
| Locus tag: | -- |
| Coding region: | -- |
| Gene name: | -- |
| Gene ID: | -- |
| Gene Sequence: | -- |
| IDs | Q.start | Q.end | S.start | S.end | Identity | E-value |
| anti_CRISPR0499 | 2 | 158 | 3 | 151 | 44.375 | 2.28e-34 |
| anti_CRISPR0490 | 1 | 161 | 3 | 130 | 28.571 | 4.94e-13 |
| anti_CRISPR0498 | 88 | 153 | 69 | 139 | 35.135 | 3.01e-09 |
| anti_CRISPR0498 | 33 | 61 | 105 | 133 | 24.138 | 4.0 |