General information
| Anti-CRISPR ID: | anti_CRISPR0492 |
| Accession: | EGE18854.1 |
| Anti-CRISPR type: | I-F |
| Family: | AcrIF13 |
| Organism: | |
| Taxonomy: | Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;Moraxellaceae; Moraxella. |
| Uniprot entry: | -- |
| Uniprot entry name: | -- |
| Structure: | -- |
| Inhibition stage: | |
| Complexed with: | |
| Interactor (DIP): | -- |
| Interactor (STRING): | -- |
| Protein sequence: | MKLLNIKINEFAVTANTEAGDELYLQLPHTPDSQHSINHEPLDDDDFVKEVQEICDEYFGKGDRTLARLSYAGGQAYDSYTEEDGVYTTNTGDQFVEHSYADYYNVEVYCKADLV |
| Length of sequence: | 115 |
| Verified: | Verified |
| Comments: | It completely inhibited I-F function |
| Pubmed: | PMID:30190308 Marino Nicole D,Zhang Jenny Y,Borges Adair L et al. Discovery of widespread type I and type V CRISPR-Cas inhibitors.[J] .Science, 2018, 362: 240-242. |
| Locus tag: | E9U_08473 |
| Coding region: | AERJ01000026.1:95577..95924 |
| Gene name: | -- |
| Gene ID: | -- |
| Gene Sequence: | -- |