| Anti-CRISPR ID: | anti_CRISPR0435 |
| Accession: | NP_666537.1 |
| Anti-CRISPR type: | I-D |
| Family: | AcrID1 |
| Organism: | |
| Taxonomy: | Viruses;dsDNA viruses, no RNA stage;Ligamenvirales;Rudiviridae;Rudivirus |
| Uniprot entry: | Q8V9R5 |
| Uniprot entry name: | Q8V9R5_9VIRU |
| Structure: | -- |
| Inhibition stage: | |
| Complexed with: | |
| Interactor (DIP): | -- |
| Interactor (STRING): | -- |
| Protein sequence: | MKKMKFETLKNMINPVFENSEIWEVDLIFSEEIELTEDEYKDLTKNADPLQEIINDTTGVNIYTDTYEWWEFNNQYLELEIDYYRQNDKIYLLELHFWRKVKK |
| Length of sequence: | 103 |
| Verified: | Verified |
| Comments: | AcrID1 protein inhibits the CRISPR-Cas subtype I-D system by interacting directly with Cas10d protein, which is required for the interference stage |
| Pubmed: | PMID:29507349 He Fei,Bhoobalan-Chitty Yuvaraj,Van Lan B et al. Anti-CRISPR proteins encoded by archaeal lytic viruses inhibit subtype I-D immunity.[J] .Nat Microbiol, 2018, 3: 461-469. |
| Locus tag: | SIRV2gp03 |
| Coding region: | NC_004086.1:2121..2432 |
| Gene name: | -- |
| Gene ID: | IPR009804 |
| Gene Sequence: | -- |
Anti-CRISPRdb
Database of anti-CRISPR proteins