| Anti-CRISPR ID: | anti_CRISPR0423 |
| Accession: | WP_034542279.1 |
| Anti-CRISPR type: | VI-B |
| Family: | AcrVIB |
| Organism: | |
| Taxonomy: | Bacteria;Bacteroidetes;Bacteroidia;Bacteroidales;Bacteroidaceae;Bacteroides |
| Uniprot entry: | -- |
| Uniprot entry name: | -- |
| Structure: | -- |
| Inhibition stage: | |
| Complexed with: | |
| Interactor (DIP): | -- |
| Interactor (STRING): | -- |
| Protein sequence: | MNKFSLYDFLSILLPGVIFLVAIRVAQPFWRFNTGLYFPQGWEFSLVYSLVIGASLYVLGFSVKKNYSVFFRRLGLYEHVTILYHRFETLHPFMNGALNKYAEEWNGTKPYCTVEQYDAMDASAQKEIEDAQDIFYDHMYYRLDCKGKLEGAKAFQSYYLCFLHSFLGLLIFGVYLLICILLSYFMDVLLADTWQVAFLFLMNLCVMYLFMRLARWFRQRMVLKMYWAFYESLIE |
| Length of sequence: | 235 |
| Verified: | literature |
| Comments: | Csx27, was identified as an inhibitor for both B. zoohelcum Cas13b (type VI-B1) and P. buccae Cas13b (type VI-B2) systems |
| Pubmed: | PMID:28065598 Smargon Aaron A,Cox David B T,Pyzocha Neena K et al. Cas13b Is a Type VI-B CRISPR-Associated RNA-Guided RNase Differentially Regulated by Accessory Proteins Csx27 and Csx28.[J] .Mol. Cell, 2017, 65: 618-630.e7. |
| Locus tag: | -- |
| Coding region: | -- |
| Gene name: | -- |
| Gene ID: | -- |
| Gene Sequence: | -- |
| IDs | Q.start | Q.end | S.start | S.end | Identity | E-value |
| anti_CRISPR0430 | 1 | 233 | 1 | 214 | 22.176 | 5.95e-09 |
| anti_CRISPR0432 | 136 | 233 | 100 | 196 | 31.000 | 7.81e-09 |
| anti_CRISPR0432 | 40 | 63 | 115 | 141 | 37.037 | 2.5 |