| Anti-CRISPR ID: | anti_CRISPR0332 |
| Accession: | AKI52063.1 |
| Anti-CRISPR type: | II-A |
| Family: | AcrIIA3 |
| Organism: | |
| Taxonomy: | Bacteria;Firmicutes;Bacilli;Bacillales;Listeriaceae;Listeria |
| Uniprot entry: | -- |
| Uniprot entry name: | -- |
| Structure: | -- |
| Inhibition stage: | |
| Complexed with: | |
| Interactor (DIP): | -- |
| Interactor (STRING): | -- |
| Protein sequence: | MYNKAEIMKQAWNWFNDSNIWLSDIEWVSYTDKEKSFSVCLKAAWSKAKEEVEESKKESKYIAKSEELKAWNWAERKLGLRFNISDDEKFTSVKDETKINFGLSVWACAMKAVKLHNDLFPQTAA |
| Length of sequence: | 125 |
| Verified: | literature |
| Comments: | -- |
| Pubmed: | PMID:28041849 Rauch Benjamin J,Silvis Melanie R,Hultquist Judd F et al. Inhibition of CRISPR-Cas9 with Bacteriophage Proteins.[J] .Cell, 2017, 168: 150-158.e10. |
| Locus tag: | L1846_01340 |
| Coding region: | complement(CP007688.1:1267179..1267556) |
| Gene name: | -- |
| Gene ID: | -- |
| Gene Sequence: | -- |
| IDs | Q.start | Q.end | S.start | S.end | Identity | E-value |
| anti_CRISPR0338 | 1 | 125 | 1 | 125 | 97.600 | 2.57e-90 |