| Anti-CRISPR ID: | anti_CRISPR0134 |
| Accession: | AEO04364.1 |
| Anti-CRISPR type: | II-A |
| Family: | AcrIIA1 |
| Organism: | |
| Taxonomy: | Bacteria;Firmicutes;Bacilli;Bacillales;Listeriaceae;Listeria |
| Uniprot entry: | -- |
| Uniprot entry name: | -- |
| Structure: | 5Y6A: 5Y69: |
| Inhibition stage: | |
| Complexed with: | |
| Interactor (DIP): | -- |
| Interactor (STRING): | -- |
| Protein sequence: | MTIKLLDEFLKKHDLTRYQLSKLTGISQNTLKDQNEKPLNKYTVSILRSLSLISGLSVSDVLFELEDIEKNSDDLAGFKHLLDKYKLSFPAQEFELYCLIKEFESANIEVLPFTFNRFENEEHVNIKKDVCKALENAITVLKEKKNELL |
| Length of sequence: | 149 |
| Verified: | Verified |
| Comments: | This protein prevents Cas9 binding and gene editing in bacteria and human cells, including currently the most widely used Cas9 from Streptococcus pyogenes |
| Pubmed: | PMID:28041849 Rauch Benjamin J,Silvis Melanie R,Hultquist Judd F et al. Inhibition of CRISPR-Cas9 with Bacteriophage Proteins.[J] .Cell, 2017, 168: 150-158.e10. |
| Locus tag: | LMOG_03146 |
| Coding region: | CP002001.1:2360593..2361042 |
| Gene name: | -- |
| Gene ID: | -- |
| Gene Sequence: | -- |